powered by:
Protein Alignment CG42456 and Dpm2
DIOPT Version :9
Sequence 1: | NP_001163338.1 |
Gene: | CG42456 / 8674033 |
FlyBaseID: | FBgn0259933 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_034203.1 |
Gene: | Dpm2 / 13481 |
MGIID: | 1330238 |
Length: | 84 |
Species: | Mus musculus |
Alignment Length: | 62 |
Identity: | 22/62 - (35%) |
Similarity: | 34/62 - (54%) |
Gaps: | 3/62 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 IILISAIAVFFYYFFWVAVLPFMLIDEGNPIRLFFPPLKYAFIVPTVFGVIFLGGIAAFSFY 71
::.:|.| :|.||..||.:||| ||..:.|..:|.|..||.::|...|::.|..:..|..|
Mouse 13 LVAVSLI-IFTYYTTWVILLPF--IDSQHVIHKYFLPRAYAVLLPLAAGLLLLLFVGLFITY 71
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42456 | NP_001163338.1 |
DPM2 |
8..68 |
CDD:399936 |
20/57 (35%) |
Dpm2 | NP_034203.1 |
DPM2 |
5..78 |
CDD:284664 |
22/62 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006485 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105019 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR15039 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.000 |
|
Return to query results.
Submit another query.