DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42556 and CG12118

DIOPT Version :9

Sequence 1:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_572537.1 Gene:CG12118 / 31857 FlyBaseID:FBgn0030101 Length:284 Species:Drosophila melanogaster


Alignment Length:229 Identity:58/229 - (25%)
Similarity:92/229 - (40%) Gaps:52/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DLDDMEPEDE----EGVMNHQYPILHSRHSDLFYMPNCVGPAYQGLISSLDQPYTTDCYMADEQT 99
            ||||   :||    |...|.:   |.:...:.||:||.:|||:||                    
  Fly    70 DLDD---DDELNSLESEPNWE---LTAERGNRFYLPNGIGPAWQG-------------------- 108

  Fly   100 LVKENDSIHDTILESL-------------VAPTEMCVVACPKLLLTYMRRLFQHPYARFGSSMNF 151
                 ||....:||.|             .:..|.....||.|:...:..:|..|... ...:|.
  Fly   109 -----DSTTVGLLEPLGHLVNFHKGPNTDKSRLEFTCCKCPLLIRVPLLEIFPVPVVA-QQCINI 167

  Fly   152 SMIGLRFKDKDANKALTSFVHFASYNSREIMDNGYWADFINPLTGRAYYRAAHCIRKQGLEAQLL 216
            :|:.|. .:.|.......||..|......::..||||||:||.:||.::..........|:::..
  Fly   168 TMLVLS-HEGDIEMGAAKFVLAAREMCDRLLSYGYWADFMNPFSGRPFFLPREGANLYRLDSRFR 231

  Fly   217 GRGLNLTFANGCTIIGEEQSD--QLTGFIFTDTP 248
            |..:.|:..|.||:|..|::|  :.:|.|::..|
  Fly   232 GLNMRLSEQNRCTVISAEKNDSTRFSGTIYSTAP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 34/132 (26%)
CG12118NP_572537.1 DUF2246 22..275 CDD:287231 58/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363001at2759
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - P PTHR13192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.