DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42556 and lpd-3

DIOPT Version :9

Sequence 1:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001300467.1 Gene:lpd-3 / 171926 WormBaseID:WBGene00003060 Length:4022 Species:Caenorhabditis elegans


Alignment Length:262 Identity:44/262 - (16%)
Similarity:67/262 - (25%) Gaps:124/262 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GSSSFPELAFFDDLDDM------------------------EPEDEEGVMNHQYPILHSRHSDLF 67
            |.:.|....||.|:|::                        :|:..:.|:....||| |....:|
 Worm  1046 GCACFGNTCFFGDVDEIGSTFMETLTKKKFFVPGIERNPEKQPQVMQSVILKNKPIL-SNQPHMF 1109

  Fly    68 YMPNCVGPAYQGLISSLDQPYTTDCYMADEQTLVKENDSIHDTILESLVAPTEMCVVACPKLLLT 132
            |                .:|...|..:...:....:.:|.|..                      
 Worm  1110 Y----------------KKPKNADVVITIRKESTGDTESFHSA---------------------- 1136

  Fly   133 YMRRLFQHPYARFGSSMNFSMIGLRFKD----------------------------------KDA 163
               |..|.|..|...||..|.....|.|                                  .|.
 Worm  1137 ---RSQQSPGLRILQSMEMSSSYATFVDNVRVELPSAITVPQFGEPGAILEWCQAHQATRIINDV 1198

  Fly   164 NKALTSFVHFAS---------YNS-------REIMDNGYWAD----FINPLTGRAYYR----AAH 204
            |.:..:.|.|.|         ||:       |.:..||..|.    |:.|:...|:.|    |:|
 Worm  1199 NTSGVNEVRFLSKPKKSQDIEYNTSRDTLGKRRLAINGVAATSLDLFVTPIGIEAFERLVTAASH 1263

  Fly   205 CI 206
            .:
 Worm  1264 SV 1265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 26/148 (18%)
lpd-3NP_001300467.1 FSA_C 3367..>3864 CDD:313663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.