DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42556 and Mmadhc

DIOPT Version :9

Sequence 1:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_006497659.1 Gene:Mmadhc / 109129 MGIID:1923786 Length:403 Species:Mus musculus


Alignment Length:172 Identity:42/172 - (24%)
Similarity:66/172 - (38%) Gaps:47/172 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FYMPNCVG--------------PAYQGLISSLDQPYTTDCY---MA-------DEQTLVKENDSI 107
            |.:|..:|              .|::.|...|.:|.:|:.:   ||       |....|::..:.
Mouse   179 FQLPGNIGFDCHLNGTASQKKSQAHKTLPDVLAEPLSTERHEFVMAQYVNEFQDSDAPVEQEINS 243

  Fly   108 HDTILESLVAPTEMCVVACPKLLLTYMRRLFQHPYARFGSSMNFSMIGLRFKDKDANK------- 165
            .:|..||  |..|..:..||:||    ||.|:   :.|....|..::.|....|..|.       
Mouse   244 AETYFES--AKVECAIQTCPELL----RRDFE---SLFPEVANSKLMILTVTQKTENDMTVWSEE 299

  Fly   166 -------ALTSFVHFASYNSREIMDNGYWADFINPLTGRAYY 200
                   .|..|:..|......:...|||||||:|.:|.|::
Mouse   300 VEVEREVLLEKFISGAKEICYALRAEGYWADFIDPSSGVAFF 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 27/98 (28%)
MmadhcXP_006497659.1 MMADHC 131..400 CDD:370900 42/172 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - LDO PTHR13192
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.