DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24Bd and Sfp24Bb

DIOPT Version :10

Sequence 1:NP_001162860.1 Gene:Sfp24Bd / 8674028 FlyBaseID:FBgn0259953 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001162861.1 Gene:Sfp24Bb / 8674094 FlyBaseID:FBgn0259952 Length:110 Species:Drosophila melanogaster


Alignment Length:91 Identity:32/91 - (35%)
Similarity:43/91 - (47%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSAICLG------QKEPICRSDPSVVGNCGHKIKGYTYEVRKNNCKKFRAMACKVTGNFFRSRDA 71
            ||.:|:|      |.|..|..|...||.||.:|.||:|...:..|..:..:.|:|.||||..|..
  Fly     7 LSLMCIGIGYAQQQSEVKCFMDAIPVGECGSRIIGYSYSSVRARCVNYETIGCEVIGNFFTDRKV 71

  Fly    72 CNAKCKDTRKPAQSGVIEFFSRTVSQ 97
            |.||||.......:....:|.|..:|
  Fly    72 CEAKCKPPISFRNNPFSYYFERAFNQ 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24BdNP_001162860.1 Kunitz-type 20..76 CDD:444694 22/55 (40%)
Sfp24BbNP_001162861.1 None

Return to query results.
Submit another query.