DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and Adcy7

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_445848.1 Gene:Adcy7 / 84420 RGDID:619966 Length:1100 Species:Rattus norvegicus


Alignment Length:253 Identity:80/253 - (31%)
Similarity:126/253 - (49%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   856 RLLC--EEKMKTED------------LLHRMLPQSVAEKLTMGQGVEP---VSYDLVTIYFSDI- 902
            ||.|  ::|.|.|.            ||..:||..||......:..|.   .|||.|.:.|:.: 
  Rat   842 RLDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYDCVCVMFASVP 906

  Fly   903 ---VGFTAMSAESTPLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDAYMVVSGLPIKNGDR- 960
               |.:|........|:.:..||::...||.::   :...|.|::|||..||..:||.:.:|.. 
  Rat   907 DFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVPSGHEN 971

  Fly   961 --------HAGEIASMALEL---LHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCL 1014
                    |.|.:...::.|   |..:.:|..     .:.:||:|::.|||:|||:|...|:|.:
  Rat   972 QDLERKHVHIGVLVEFSMALMSKLDGINRHSF-----NSFRLRVGINHGPVIAGVIGARKPQYDI 1031

  Fly  1015 FGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWL 1072
            :|:|||.||||||.||..||.::.:....|.  |.||..|.|||:|:||||::.|:::
  Rat  1032 WGNTVNVASRMESTGELGKIQVTEETCTILQ--GLGYSCECRGLINVKGKGELRTYFV 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 12/38 (32%)
CYCc 860..1052 CDD:214485 66/225 (29%)
Guanylate_cyc 887..1074 CDD:278633 68/208 (33%)
Adcy7NP_445848.1 AC_N <21..251 CDD:318454
Guanylate_cyc 272..422 CDD:306677
DUF1053 487..593 CDD:399378
Guanylate_cyc 891..1087 CDD:306677 67/202 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.