DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and CRLK2

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001078591.1 Gene:CRLK2 / 831429 AraportID:AT5G15730 Length:436 Species:Arabidopsis thaliana


Alignment Length:261 Identity:52/261 - (19%)
Similarity:114/261 - (43%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 REIMKEMRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDII-ENEDIKL----DDLFIA 652
            ||...|:.||..|.|.|:.:..|..|:.:..:|:.::.:.|||.::: ..|.:::    :.|.||
plant   153 REFQTEVSLLGRLHHRNLVNLTGYCVDKSHRMLIYEFMSNGSLENLLYGGEGMQVLNWEERLQIA 217

  Fly   653 SLIHDLIKGMIYIHNSQL--VYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESI------- 708
            .   |:..|:.|:|...:  |.|.:|||:|.::......:|.||||       ..|.:       
plant   218 L---DISHGIEYLHEGAVPPVIHRDLKSANILLDHSMRAKVADFGL-------SKEMVLDRMTSG 272

  Fly   709 --GEHQHYRNQLWRAPELLRNHIHGSQKGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKL 771
              |.|.      :..|..:..:.: :.|.|:|:|.:|:.|:.:...|       .:.:::|:...
plant   273 LKGTHG------YMDPTYISTNKY-TMKSDIYSFGVIILELITAIHP-------QQNLMEYINLA 323

  Fly   772 PLKGEDPFRPEVESIIEAESCPDYVLACIR-------DCWAEDPEERPEFSVIRNRLKKMRGGKT 829
            .:..:.     ::.|::.:...:..:..:|       .|..:.|.:||....:...:.|::..::
plant   324 SMSPDG-----IDEILDQKLVGNASIEEVRLLAKIANRCVHKTPRKRPSIGEVTQFILKIKQSRS 383

  Fly   830 K 830
            :
plant   384 R 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 52/256 (20%)
HNOBA <835..881 CDD:285003
CYCc 860..1052 CDD:214485
Guanylate_cyc 887..1074 CDD:278633
CRLK2NP_001078591.1 S_TKc 119..373 CDD:214567 51/248 (21%)
STKc_IRAK 120..378 CDD:270968 51/253 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.