DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and adcy1b

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001161822.1 Gene:adcy1b / 569499 ZFINID:ZDB-GENE-100805-1 Length:1114 Species:Danio rerio


Alignment Length:440 Identity:113/440 - (25%)
Similarity:179/440 - (40%) Gaps:102/440 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   735 GDVYAFAIIMYEIFSRKGPFGQINFEPKEI------VDYVKKLPLKGEDPFRPEVESIIEAESCP 793
            |..|||...|....| ...|.::::.||.|      |.|:..|.|.|   ||          ...
Zfish   705 GAQYAFLCCMLGTLS-MALFLRVSWIPKTILLLLLLVLYITILELSG---FR----------RAS 755

  Fly   794 DYVLACIRDCWAEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLL 858
            .:.|..:|..       .|..|::   |...........:|..:.:...:|...|:   ||..: 
Zfish   756 GWALLSVRGL-------EPLLSLL---LFSTAVALHSRQLDLKLRLDFLWATQAEE---ERDGM- 806

  Fly   859 CEEKMKTED--LLHRMLPQSVAEKLTMGQGVEPVSYDL-------VTIYFSDIVGFT----AMSA 910
              ||:|.::  :|..:||..||:...:.   .|.:.||       |.:.|:.|..|.    .:..
Zfish   807 --EKVKLDNKRILFNLLPVHVAQHFLLS---NPRNMDLYYQSYAQVGVLFASIPNFNDFYIELDG 866

  Fly   911 ESTPLQVVNFLNDLYTVFDRII--RGY-DVYKVETIGDAYMVVSGLPIKNGDR-------HAGEI 965
            .:..::.:..||::...||.::  ..| |:.|::|||..||...||....|.:       |...|
Zfish   867 NNMGVECLRLLNEIIADFDELMDKECYKDIEKIKTIGSTYMSAVGLVPTIGTKAKKSTATHLSTI 931

  Fly   966 ASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGE 1030
            |..|:|:...:.:  |.::......||:|::.|||||||:|...|:|.::|:|||.||||:|.|.
Zfish   932 ADFAIEMFDVLDE--INYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGV 994

  Fly  1031 ALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTGANENAIQKKLVDMMDMPPPLF 1095
            ..||.::......|.   ..|....||.|::||||.::|::|.|                     
Zfish   995 PGKIQVTEDVYRLLQ---NNYDLMCRGNVSVKGKGQMLTYFLEG--------------------- 1035

  Fly  1096 SRPRKSPKLNPDSRQPSIQAMHFCGTGSRRQSTVPRAMDGESTYSLQGSV 1145
                       .::.|.|:|.|..|...||...:.|.   .||.:..|||
Zfish  1036 -----------KAQDPGIRAPHHTGGLERRVHAIART---SSTQTKAGSV 1071

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 22/97 (23%)
HNOBA <835..881 CDD:285003 12/47 (26%)
CYCc 860..1052 CDD:214485 62/214 (29%)
Guanylate_cyc 887..1074 CDD:278633 64/207 (31%)
adcy1bNP_001161822.1 AC_N <128..270 CDD:292831
CYCc 236..431 CDD:214485
Guanylate_cyc 272..454 CDD:278633
DUF1053 498..585 CDD:283888
CYCc 806..1012 CDD:214485 62/216 (29%)
Guanylate_cyc 839..1035 CDD:278633 62/200 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.