DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and ADCY10

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_060887.2 Gene:ADCY10 / 55811 HGNCID:21285 Length:1610 Species:Homo sapiens


Alignment Length:266 Identity:60/266 - (22%)
Similarity:109/266 - (40%) Gaps:73/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   785 SIIEAESCPDYVLACIRDCWAEDPEERPEFSV------IRNRLKKMRGGKTKNIM--------DQ 835
            |:||.||.||.  ..::..:.:.|   |.|:.      ....:.....|:.||::        |.
Human   200 SMIEIESVPDQ--RAVK
VNFLKPP---PNFNFDEFFTKCTTFMHYYPSGEHKNLLRLACTLKPDP 259

  Fly   836 MMEM-MEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYF 899
            .:|| ::||.  :|.|:              :.:.::.|...::|       :.||:...|.:.|
Human   260 ELEMSLQKYV--MESIL--------------KQIDNKQLQGYLSE-------LRPVTIVFVNLMF 301

  Fly   900 SDIVGFTAMSAESTPLQVVNFLNDLY---TVFDRIIRGYDVYKVETI--GDAYMVVSGLPIKNGD 959
            .|         :....::...:.|.|   |...:|.:| .:.||...  |.:::.|.|.|   |:
Human   302 ED---------QDKAEEIGPAIQDAYMHITSVLKIFQG-QINKVFMFDKGCSFLCVFGFP---GE 353

  Fly   960 RHAGEIA---SMALELLHAVKQ-HRIAHRPNETLKLRIGMHTGPVVAGVVGLTM-PRYCLFGDTV 1019
            :...|:.   ..|:::.....| |:|     :|:.  ||:.:|.|..|:||.|: ..|.:.|..|
Human   354 KVPDELTHALECAMDIFDFCSQVHKI-----QTVS--IGVASGIVFCGIVGHTVRHEYTVIGQKV 411

  Fly  1020 NTASRM 1025
            |.|:||
Human   412 NLAARM 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 10/47 (21%)
HNOBA <835..881 CDD:285003 8/46 (17%)
CYCc 860..1052 CDD:214485 40/176 (23%)
Guanylate_cyc 887..1074 CDD:278633 38/149 (26%)
ADCY10NP_060887.2 CHD 40..214 CDD:143636 7/15 (47%)
AcyC <42..197 CDD:225025
CHD 292..461 CDD:143636 37/146 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.