DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and Gucy1b1

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_059497.1 Gene:Gucy1b1 / 54195 MGIID:1860604 Length:620 Species:Mus musculus


Alignment Length:682 Identity:179/682 - (26%)
Similarity:278/682 - (40%) Gaps:214/682 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 KWKIELEIEG-LLWKIDPNEIKGYSGNEIVSSPSKVSLMSA----QSYGSRWTNQFVTSTG---- 571
            |.:.:|:.|| .|.:|..::.|.|   ::|::.|||..::|    |.:|..:. .|...:|    
Mouse    26 KKEAQLDEEGQFLVRIIYDDSKTY---DLVAAASKVLNLNAGEILQMFGKMFF-VFCQESGYDTI 86

  Fly   572 -RLRGAVVRIKELKFPRKRDISREIMKEMRLLRELRHDNI---------NSFIGASVEPTRILLV 626
             |:.|:.|              ||.::.:..|    ||::         .||.....|..:.|::
Mouse    87 LRVLGSNV--------------REFLQNLDAL----HDHLATIYPGMRAPSFRCTDAEKGKGLIL 133

  Fly   627 TDYCAKGSLYDI-----------------------------------IENEDIKLDDLFIASLIH 656
            ..|..:..|.||                                   ||.::.|.:|.:     .
Mouse   134 HYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFY-----E 193

  Fly   657 DLIK----------------------GMIYIHNSQLVYHGN--------LKSSNCVVTSRWMLQV 691
            ||.:                      .:|:..|..:...||        |:..||.:.|.:    
Mouse   194 DLDRFEENGTQESRISPYTFCKAFPFHIIFDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVF---- 254

  Fly   692 TDFGLHELRQCAENESIGEHQHYRNQLWRAPELLRNHIHGSQKGDVYAFAIIMY--EIFSRKGPF 754
                                           .|:|.||      |:....|:.:  .:|..:...
Mouse   255 -------------------------------SLVRPHI------DISFHGILSHINTVFVLRSKE 282

  Fly   755 GQINFEPKEIVD-----YVKKLPLKGEDPFRPEVESIIEAESCPDYVLACIRDCWAEDPEERPEF 814
            |.::.|..|..|     .:..|.|||:..:.||.:||:         ..|.......|...|   
Mouse   283 GLLDVEKLECEDELTGAEISCLRLKGQMIYLPEADSIL---------FLCSPSVMNLDDLTR--- 335

  Fly   815 SVIRNRLKKMRG---------GKTKNIMDQMMEMMEKYANNLE-DIVTERTRL----LCEEKMKT 865
                      ||         ..|::::....:..|:|....| :|:|:|.:|    |.:||.||
Mouse   336 ----------RGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKT 390

  Fly   866 EDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAEST----PLQVVNFLNDLYT 926
            :.||:.:||.|||.:|...:.|....||.|||.||.||||.|..::..    .:::||.||||||
Mouse   391 DTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYT 455

  Fly   927 VFDRII---RGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNET 988
            .||.:.   :...||||||:||.||.||||| :....||..|..:||:::....|.::   ..|:
Mouse   456 RFDTLTDSRKNPFVYKVETVGDKYMTVSGLP-EPCIHHARSICHLALDMMEIAGQVQV---DGES 516

  Fly   989 LKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISN---KCKLALDKLGGG 1050
            :::.||:|||.||.||:|..||||||||:|||..||.|:.||..||::|.   :|.::.:.....
Mouse   517 VQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPL 581

  Fly  1051 YITEKRGLVNMKGKGDVVTWWL-----TGANE 1077
            :..|.||.|:||||.:.:..|.     ||..|
Mouse   582 FHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEE 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 63/382 (16%)
HNOBA <835..881 CDD:285003 19/50 (38%)
CYCc 860..1052 CDD:214485 87/201 (43%)
Guanylate_cyc 887..1074 CDD:278633 84/201 (42%)
Gucy1b1NP_059497.1 HNOB 2..166 CDD:311572 33/161 (20%)
HNOBA 207..406 CDD:311573 52/261 (20%)
Guanylate_cyc 412..605 CDD:306677 84/196 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.