DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and ACXE

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster


Alignment Length:324 Identity:76/324 - (23%)
Similarity:132/324 - (40%) Gaps:99/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   868 LLHRMLPQSVAEKLTMGQGVEPV---SYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFD 929
            :|:.:||..:.:..........:   :|.:|::.|:.::.|      ...|:.:..||::...||
  Fly   829 ILNNILPSHIVDVYLNSLAKHELYFENYRMVSVMFAMLINF------EMDLRSLRVLNEIIAEFD 887

  Fly   930 RIIRGYDVY----KVETIGDAYMVVSGLPIKNGDRHAGEIASMALELL----------------- 973
            .::..|..|    |::.:|..||...||.:    ..||..::...|.:                 
  Fly   888 TLLLFYKEYYTVEKIKIVGCTYMAACGLDL----NFAGSTSTNRKESIPPTEFNEEQSRRILFQQ 948

  Fly   974 --------------HAVKQHRIAHRPNETLK------------LRIGMHTGPVVAGVVGLTMPRY 1012
                          :|:...|...:.||..:            :.||:.:|.|:||:||.:.|.|
  Fly   949 SNEDLDEVVFVMTSYALDMMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEVMAGIVGASQPHY 1013

  Fly  1013 CLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYIT-EKRGLVNMKGKGDVVTWWLTGAN 1076
            .::|:.||.||||||.|....||::.:....|.:.|   || ..||:..:||:|.:.| :|.|.:
  Fly  1014 DIWGNPVNMASRMESTGLPGHIHVTEETSEILQQFG---ITCSYRGMTFVKGRGKIPT-YLVGID 1074

  Fly  1077 ENAIQKKLVDMMDMPPPLFSRPRKSPKLNPDSRQPSIQAMHFCGTGSRRQSTVPRAMDGESTYS 1140
            ||               |...|:|:      :|.||.|          .:|||   :..:|||:
  Fly  1075 EN---------------LNFIPQKA------TRFPSHQ----------ERSTV---ISLQSTYT 1104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 3/12 (25%)
CYCc 860..1052 CDD:214485 51/233 (22%)
Guanylate_cyc 887..1074 CDD:278633 57/237 (24%)
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 56/233 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454007
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.