DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and Gycalpha99B

DIOPT Version :10

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster


Alignment Length:229 Identity:100/229 - (43%)
Similarity:136/229 - (59%) Gaps:19/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   827 GKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVS 891
            |:.....|.:...|:|..|::|    |....:.:|:.|...|||.:.|..:||||.:|..::..:
  Fly   401 GEQARAQDGLRRRMDKIKNSIE----EANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKT 461

  Fly   892 YDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIK 956
            |..|||.||||||||::.:.:||..|::.|..||..||.....:||||||||||||.|.|||   
  Fly   462 YPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGL--- 523

  Fly   957 NGDRH------AGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLF 1015
                |      |.::|.|||:::.|..:| |.| ..|.:|:|||:|||.|:|||||..|||||||
  Fly   524 ----HRASIYDAHKVAWMALKMIDACSKH-ITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLF 582

  Fly  1016 GDTVNTASRMESNGEALKIHISNKCKLALDKLGG 1049
            |.:|..|::.||..|||||::|...|..|.|..|
  Fly   583 GHSVTIANKFESGSEALKINVSPTTKDWLTKHEG 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_SAP_GC-like 26..445 CDD:380593
PK_GC-A_B 543..827 CDD:270944 100/229 (44%)
HNOBA <833..881 CDD:462234 14/47 (30%)
CYCc 860..1052 CDD:214485 93/196 (47%)
Gycalpha99BNP_477088.2 HNOB <109..208 CDD:462233
HNOBA 259..451 CDD:462234 15/53 (28%)
Guanylate_cyc 457..647 CDD:425528 82/169 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.