DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and CG14877

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:229 Identity:56/229 - (24%)
Similarity:86/229 - (37%) Gaps:54/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLLSVAV----------------RDC-----SNHRTVLTVGYLTALTGDLKTRQGLAISGALT 51
            ||:||.|.:                |||     :|.|. .|:..|..|..|...:..|.....:.
  Fly     2 LLVLLLVGLVFGPKDCVATCREEPARDCEAICDANGRN-CTIRALVLLPDDNMYQASLPRVLPIL 65

  Fly    52 MALDEVNKDPNLLPNVYLDLRW--NDTKGDTVLAT-KAITEMICDGIATIFGPEGPC-YVEAIVS 112
            ...::..:..:|:|: ::|..|  :|||.|..|.. ||:..:|......||||  .| |..|.||
  Fly    66 KVAEQQIRSKSLIPS-HIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGP--VCDYSLAAVS 127

  Fly   113 Q------SRNIPMISYKCAEYRASAIPT--------FARTEPPDTQVVKSL-LALLRYYAWNKFS 162
            :      |:..|:||...:.|......|        ..||.....:.:..| :.:::.:.|:...
  Fly   128 RITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHSI 192

  Fly   163 ILYE-DVWSPVADL---------LKDQATKRNMT 186
            ..|| |....||.:         |..|....|||
  Fly   193 FYYERDGQRSVAGMHTCFLMMKSLGKQMRNENMT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365 46/190 (24%)
ANF_receptor 48..412 CDD:279440 41/168 (24%)
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003
CYCc 860..1052 CDD:214485
Guanylate_cyc 887..1074 CDD:278633
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 44/184 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.