DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and rut

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster


Alignment Length:552 Identity:131/552 - (23%)
Similarity:222/552 - (40%) Gaps:172/552 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   832 IMDQMMEMMEK---------YANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGV 887
            :::.|||..::         .|:.||         :.:|..|.|.||..:|||.||.:: ....:
  Fly   202 VVNIMMERAQRRTFLDTRNCIASRLE---------IQDENEKLERLLLSVLPQHVAMQM-KNDIL 256

  Fly   888 EPVS----------YDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVET 942
            .||:          ::.|:|.|:||||||.:|::.:..::|..||:|:..||::.......:::.
  Fly   257 SPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDNHCLRIKI 321

  Fly   943 IGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGL 1007
            :||.|..|||||....| ||.....|.|:::.|:.  .:....:..|.:|:|:|||.|:.||:||
  Fly   322 LGDCYYCVSGLPEPRKD-HAKCAVEMGLDMIDAIA--TVVEATDVILNMRVGIHTGRVLCGVLGL 383

  Fly  1008 TMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWL 1072
            ...::.::.:.|..|:.|||.||..::|::   :..||.|.|.|..|       .|.||..:.:|
  Fly   384 RKWQFDVWSNDVTLANHMESGGEPGRVHVT---RATLDSLSGEYEVE-------AGHGDERSSYL 438

  Fly  1073 TGANENAIQKKLVDMMDMPPPLFSRPRKSPKLNPDSRQPSI----------------QAMHFC-- 1119
               .::.:....:    :|||   ..||...||....:.:|                |.:|..  
  Fly   439 ---RDHGVDTFFI----VPPP---HRRKPLMLNTLGVRSAIGSRRKLSFRNVSNVVMQLLHTIKF 493

  Fly  1120 ----------------------------------GTGSRRQSTVPRAMDGESTYSLQGSVRESPR 1150
                                              |.|..|.||. .|..|    ::|.|.:.|.:
  Fly   494 SEPVPFSNIATGSFPSAASALGGGVSVGGGGGGGGGGVARGSTC-EANSG----NVQVSEKGSRK 553

  Fly  1151 MVSKRDRDRERPPINGLGAGHFVG-GALLESAQASLSTLNHSETNETNCDMDGGSGGVSG--SGS 1212
            ::..:......||.:|:|.|..|| |..::|.                  :.||.|.|||  :|.
  Fly   554 VIRLQKILHATPPPHGMGYGSVVGSGGGVDSG------------------ISGGGGCVSGGIAGG 600

  Fly  1213 GLVRQPNALHKPLAMVRPHRIISAAQLPQLGDNDDDSADTLLR-----------ESRSLDPMPMQ 1266
            |.|:                       ..:|.|.:.:|.|:.|           :|:..|.. .:
  Fly   601 GGVQ-----------------------VTVGTNPNSTASTISRIHRHNHKNNKSQSKVADKF-KR 641

  Fly  1267 QLRKRHDRV--KLPPSKLSK-----NNSRSLD 1291
            ..||||...  ..|.:::::     .|:||:|
  Fly   642 PFRKRHSVAAHHQPTNRVNRFLSQAINARSVD 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 16/54 (30%)
CYCc 860..1052 CDD:214485 65/201 (32%)
Guanylate_cyc 887..1074 CDD:278633 61/196 (31%)
rutNP_511156.2 AC_N <17..255 CDD:292831 16/62 (26%)
CYCc 230..425 CDD:214485 65/201 (32%)
Guanylate_cyc 266..438 CDD:278633 58/184 (32%)
DUF1053 624..696 CDD:283888 11/51 (22%)
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.