DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and CG32305

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster


Alignment Length:220 Identity:62/220 - (28%)
Similarity:112/220 - (50%) Gaps:14/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   830 KNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKM--KTEDLLHRMLPQSVA-EKLTMGQGVEPVS 891
            :||:.|:  :|:|....||.|:..:.....:|::  :.||......|.... .||.:    ||  
  Fly   237 QNIVYQL--VMKKENGLLESILPRKMIRTLQEEICSRIEDQDKNFTPSKAGLRKLFL----EP-- 293

  Fly   892 YDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIK 956
            |..|:|..:|:|.:|.::......|:|..|:||:..||.........:::.:||:|..|:|:| .
  Fly   294 YPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNCVAGIP-N 357

  Fly   957 NGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNT 1021
            ....||......|||::|..:  .::.|....:.||||:|:|.|.||::|.|..::.::...|:.
  Fly   358 YFPAHASCCVDQALEMIHITQ--GVSSRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVDI 420

  Fly  1022 ASRMESNGEALKIHISNKCKLALDK 1046
            .:|:||:|....:|:|.:....||:
  Fly   421 TNRLESSGLPGLVHVSQRTLSMLDE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 10/48 (21%)
CYCc 860..1052 CDD:214485 54/190 (28%)
Guanylate_cyc 887..1074 CDD:278633 48/160 (30%)
CG32305NP_728725.2 CYCc 251..449 CDD:214485 57/204 (28%)
Nucleotidyl_cyc_III 292..445 CDD:299850 47/157 (30%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.