DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and Adcy1

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001100709.1 Gene:Adcy1 / 305509 RGDID:1309318 Length:967 Species:Rattus norvegicus


Alignment Length:299 Identity:78/299 - (26%)
Similarity:142/299 - (47%) Gaps:49/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   862 KMKTEDLLHRMLPQSVAEKLTM----GQGVEPVSYDLVTIYFSDIVGFT----AMSAESTPLQVV 918
            |:..:.:|..:||..||:...|    ...:...||..|.:.|:.|..|.    .:...:..::.:
  Rat   677 KLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECL 741

  Fly   919 NFLNDLYTVFDRII-RGY--DVYKVETIGDAYMVVSGLPIKNGDR-------HAGEIASMALELL 973
            ..||::...||.:: :.:  |:.|::|||..||...||....|.|       |...:|..|:::.
  Rat   742 RLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTRAKKSISSHLSTLADFAIDMF 806

  Fly   974 HAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISN 1038
            ..:.:  |.::......||:|::.|||||||:|...|:|.::|:|||.||||:|.|...:|.::.
  Rat   807 DVLDE--INYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTE 869

  Fly  1039 KCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTGANENA--------IQKKLVDMMDMP---- 1091
            :....|::....::.  ||.|::||||:::|::|.|..:.:        :::::     .|    
  Rat   870 EVHRLLNRCSYQFVC--RGKVSVKGKGEMLTYFLEGRTDGSSSHSRSLRLERRM-----FPYGRG 927

  Fly  1092 -------PPLFSRPRKSPKLNPD-SRQPSIQAMHFCGTG 1122
                   |||.  |...|.:.|. |..|:.|.:.....|
  Rat   928 GGGQARRPPLC--PAAGPPIKPGLSPAPTSQYLSSTAAG 964

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 6/18 (33%)
CYCc 860..1052 CDD:214485 57/207 (28%)
Guanylate_cyc 887..1074 CDD:278633 59/200 (30%)
Adcy1NP_001100709.1 AC_N <6..139 CDD:292831
CYCc 105..300 CDD:214485
Guanylate_cyc 141..323 CDD:278633
CYCc 673..884 CDD:214485 57/208 (27%)
Guanylate_cyc 706..903 CDD:278633 59/200 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.