DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and GUCY1B1

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:704 Identity:180/704 - (25%)
Similarity:287/704 - (40%) Gaps:201/704 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 KWKIELEIEG-LLWKIDPNEIKGYSGNEIVSSPSKVSLMSA----QSYGSRWTNQFVTSTG---- 571
            |.:.:|:.|| .|.:|..::.|.|   ::|::.|||..::|    |.:|..:. .|...:|    
Human    26 KKEAQLDEEGQFLVRIIYDDSKTY---DLVAAASKVLNLNAGEILQMFGKMFF-VFCQESGYDTI 86

  Fly   572 -RLRGAVVRIKELKFPRKRDISREIMKEMRLLRELRHDNI---------NSFIGASVEPTRILLV 626
             |:.|:.|              ||.::.:..|    ||::         .||.....|..:.|::
Human    87 LRVLGSNV--------------REFLQNLDAL----HDHLATIYPGMRAPSFRCTDAEKGKGLIL 133

  Fly   627 TDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIKGMIYI--------HNSQLVYHGNLKSSNCVV 683
            ..|..:..|.||:.. .||.    :|..||.....|..|        |...|:.....|..    
Human   134 HYYSEREGLQDIVIG-IIKT----VAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEE---- 189

  Fly   684 TSRWMLQVTDF----------GLHELR-----------------------QCAENESIGEHQHYR 715
                     ||          |..|.|                       ||.            
Human   190 ---------DFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCG------------ 233

  Fly   716 NQLWRA-PE-------------LLRNHIHGSQKGDVYAFAIIMY--EIFSRKGPFGQINFEPKEI 764
            |.::|. |:             |:|.||      |:....|:.:  .:|..:...|.::.|..|.
Human   234 NAIYRVLPQLQPGNCSLLSVFSLVRPHI------DISFHGILSHINTVFVLRSKEGLLDVEKLEC 292

  Fly   765 VD-----YVKKLPLKGEDPFRPEVESIIEA------------------------ESCPDYVLACI 800
            .|     .:..|.|||:..:.||.:||:..                        ::..|.||  :
Human   293 EDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVL--L 355

  Fly   801 RDCWAEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKT 865
            .:.:.|:.:...|..::.:||:.    ..:.:.|:..:........::....:.|.:|||:..::
Human   356 GEQFREEYKLTQELEILTDRLQL----TLRALEDEKKKTDTGCPARIQAFKVQTTLMLCEKDSRS 416

  Fly   866 -----------------EDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAEST 913
                             ..||:.:||.|||.:|...:.|....||.|||.||.||||.|..::..
Human   417 TKGFPSISYSGFLLIPLNRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHA 481

  Fly   914 ----PLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALE 971
                .:::||.||||||.||.:.   :...||||||:||.||.||||| :....||..|..:||:
Human   482 SGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLP-EPCIHHARSICHLALD 545

  Fly   972 LLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHI 1036
            ::....|.::   ..|::::.||:|||.||.||:|..||||||||:|||..||.|:.||..||::
Human   546 MMEIAGQVQV---DGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINV 607

  Fly  1037 SN---KCKLALDKLGGGYITEKRGLVNMKGKGD-VVTWWLTGANENAIQKKLVD 1086
            |.   :|.::.:.....:..|.||.|:||||.: :..|:|:..|....:.|..|
Human   608 SEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETKQDD 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 71/387 (18%)
HNOBA <835..881 CDD:285003 11/62 (18%)
CYCc 860..1052 CDD:214485 84/218 (39%)
Guanylate_cyc 887..1074 CDD:278633 85/197 (43%)
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572 39/166 (23%)
HNOBA 207..449 CDD:311573 44/265 (17%)
Guanylate_cyc 455..648 CDD:306677 84/196 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.