DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and Gucy1b2

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_011243363.2 Gene:Gucy1b2 / 239134 MGIID:2660873 Length:829 Species:Mus musculus


Alignment Length:563 Identity:172/563 - (30%)
Similarity:251/563 - (44%) Gaps:141/563 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 TDFGLHELRQCAENESIGEHQHY--------RNQLWRAPELLR----NHIHGSQK---------- 734
            ||..:..|....|.|..|:.:|.        |.|: |..::.|    .:|...|:          
Mouse   270 TDVAMSILDMNEEVERTGKKEHVVFLVVQKARRQI-RGAKVNRPRDSENIQAKQESLQGTLLRKK 333

  Fly   735 ----------GDVYAFAIIMYEIFSRKGPFGQINFEP---------KEI--------VDYVKKLP 772
                      |:....|::...:...|||.|. .|:|         :|:        |.:.:.|.
Mouse   334 ERYLSIPVCPGEKSHSAVVRASVLLGKGPLGD-TFQPVFPERLWIEEEVFCNAFPFHVVFDEALR 397

  Fly   773 LK------------------GEDPF----RPEVESIIEAESC----PDYVLACIRDCWAEDPEER 811
            :|                  |.|.:    .|:|...| :..|    ..::|...|:...|..:.:
Mouse   398 VKQAGVNIQKYVPGILTQKFGLDEYFSIVHPQVTFNI-SSICKFINSQFILKTRREMMPEAWKSQ 461

  Fly   812 PEFSVIRNRLKKMRGGKTKNIMD----QMMEMMEKYANNLEDIVTERT---------------RL 857
            |... :|.::..|...|....|.    :.::.:|:...:|.||....|               .|
Mouse   462 PTLK-LRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMEL 525

  Fly   858 LCE-----------------EKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGF 905
            .|:                 ||.|||.||:.|||:.||.:|..|:.|....::..||.|||:|.|
Mouse   526 SCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGEFETCTILFSDVVTF 590

  Fly   906 TAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMAL 970
            |.:.|...|:|:||.||.:|:.|||:...:|||||||||||||||.|:|:. .:.||..:|:.||
Mouse   591 TNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVP-VESHAQRVANFAL 654

  Fly   971 ELLHAVKQHRIAHRP--NETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALK 1033
            .:..:.|:   ...|  .|.:::|:|:|||||:|||||..|||||||||||||||||||:|...|
Mouse   655 GMRISAKE---VMNPVTGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNK 716

  Fly  1034 IHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTGANENAIQKKLVDMMDMPPPL---- 1094
            :|:|.....||:..|...:|  ||.:.:||||.:.|::|. .|.||.:   |::|..|..|    
Mouse   717 VHLSPTAHRALENKGFEIVT--RGEIEVKGKGKMTTYFLI-RNLNATE---VEIMGRPSALADGK 775

  Fly  1095 -FSRPR---KSPKL---NPDSRQPSI---QAMHFCGTGSRRQS 1127
             .|.||   |.|:.   |.|..|..:   ......||.||..|
Mouse   776 EASTPRNQVKKPRAVLSNMDHHQQQVYNSDPADVLGTASRTAS 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 37/209 (18%)
HNOBA <835..881 CDD:285003 19/77 (25%)
CYCc 860..1052 CDD:214485 97/210 (46%)
Guanylate_cyc 887..1074 CDD:278633 92/188 (49%)
Gucy1b2XP_011243363.2 HNOB 115..276 CDD:400167 2/5 (40%)
HNOBA 380..566 CDD:400168 37/187 (20%)
Guanylate_cyc 572..754 CDD:306677 91/187 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.