DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and Adcy2

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_705762.2 Gene:Adcy2 / 210044 MGIID:99676 Length:1095 Species:Mus musculus


Alignment Length:464 Identity:120/464 - (25%)
Similarity:190/464 - (40%) Gaps:120/464 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 LKSSNCVVTSRW------------MLQVTDFGLHELRQCAE-----------NESIGEHQ----H 713
            ||||..:....|            :|.:..|.:..|....|           |.|:.::|    |
Mouse   670 LKSSGIIANRPWPRISLTIVTTAIILTMAVFNMFFLSNSEETTLPTANASNANVSVPDNQTAILH 734

  Fly   714 YRNQLWRAPELLRNHIHGSQKGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKGEDP 778
            .|| |:..|..:.:.|.|          :|...:|.|      :|:|.|.::..|          
Mouse   735 ARN-LFFLPYFIYSCILG----------LISCSVFLR------VNYELKMLIMMV---------- 772

  Fly   779 FRPEVESIIEAESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMM--- 840
                  :::.......:..|.:.|.:::...:||.   |...||.| |..:.:|....:.::   
Mouse   773 ------ALVGYNIILLHTHAHVLDAYSQVLFQRPG---IWKDLKTM-GSVSLSIFFITLLVLGRQ 827

  Fly   841 -EKYANNLEDIVTERTRLLCEEKMKTED------------LLHRMLPQSVAE----KLTMGQGVE 888
             |.|.         |...|.:.|.|.|.            ||..:||..|||    :....:.:.
Mouse   828 SEYYC---------RLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELY 883

  Fly   889 PVSYDLVTIYFSDIVGFTAMSAES----TPLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDA 946
            ..|||.|.:.|:.|..|.....||    ..|:.:..||::...||.::   :...|.|::|||..
Mouse   884 HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGST 948

  Fly   947 YMVVSGLPIKNGDRHA----------GEIASMALEL---LHAVKQHRIAHRPNETLKLRIGMHTG 998
            ||..:||.......||          |.:...|..|   |.|:.:|..     ...|||:|::.|
Mouse   949 YMAATGLSAVPSQEHAQEPERQYMHIGTMVEFAYALVGKLDAINKHSF-----NDFKLRVGINHG 1008

  Fly   999 PVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKG 1063
            ||:|||:|...|:|.::|:|||.||||:|.|...||.::.:..|.|..|  ||....||::|:||
Mouse  1009 PVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTL--GYTCTCRGIINVKG 1071

  Fly  1064 KGDVVTWWL 1072
            |||:.|:::
Mouse  1072 KGDLKTYFV 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 34/177 (19%)
HNOBA <835..881 CDD:285003 14/65 (22%)
CYCc 860..1052 CDD:214485 70/227 (31%)
Guanylate_cyc 887..1074 CDD:278633 70/206 (34%)
Adcy2NP_705762.2 AC_N <37..264 CDD:292831
CYCc 240..443 CDD:214485
Guanylate_cyc 285..469 CDD:278633
DUF1053 499..603 CDD:283888
CYCc 852..1060 CDD:214485 67/214 (31%)
Guanylate_cyc 882..1081 CDD:278633 70/206 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.