DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and ADCY4

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001185497.1 Gene:ADCY4 / 196883 HGNCID:235 Length:1077 Species:Homo sapiens


Alignment Length:268 Identity:82/268 - (30%)
Similarity:128/268 - (47%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   858 LCEEKMKTED-------LLHRMLPQSVAEKLTMGQG-----VEPVSYDLVTIYFSDIVGFTAMSA 910
            |.:|:.:||.       ||..:||..||.:. :||.     :...||:.|.:.|:.:..|....:
Human   824 LRQEREETETMENLTRLLLENVLPAHVAPQF-IGQNRRNEDLYHQSYECVCVLFASVPDFKEFYS 887

  Fly   911 EST----PLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDAYMVVSGLPIKNGD--------- 959
            ||.    .|:.:..||::...||.::   :...|.|::|||..||..:||...:|.         
Human   888 ESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERS 952

  Fly   960 -RHAGEIASMALEL---LHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVN 1020
             .|.|.:...|:.|   |..:.:|..     ...:||:|::.|||||||:|...|:|.::|:|||
Human   953 CSHLGTMVEFAVALGSKLDVINKHSF-----NNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVN 1012

  Fly  1021 TASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTGANENAIQKKLV 1085
            .||||||.|...||.::.:...||..|  ||....||::.:||||.:.|::|.           .
Human  1013 VASRMESTGVLGKIQVTEETAWALQSL--GYTCYSRGVIKVKGKGQLCTYFLN-----------T 1064

  Fly  1086 DMMDMPPP 1093
            |:....||
Human  1065 DLTRTGPP 1072

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 10/29 (34%)
CYCc 860..1052 CDD:214485 69/223 (31%)
Guanylate_cyc 887..1074 CDD:278633 67/206 (33%)
ADCY4NP_001185497.1 AC_N <115..246 CDD:292831
CYCc 219..422 CDD:214485
Guanylate_cyc 264..418 CDD:278633
DUF1053 479..583 CDD:283888
CYCc 827..1042 CDD:214485 69/222 (31%)
Guanylate_cyc 864..1063 CDD:278633 66/205 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.