DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and gcy-37

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_500171.2 Gene:gcy-37 / 191658 WormBaseID:WBGene00001557 Length:708 Species:Caenorhabditis elegans


Alignment Length:270 Identity:80/270 - (29%)
Similarity:140/270 - (51%) Gaps:19/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   818 RNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLT 882
            ::|:.:|...|.   :::.|:.|:|....||           .:|.:|:.||...:|..:||.|.
 Worm   370 QSRICQMELNKK---LEETMKKMKKMTEELE-----------VKKSQTDRLLFEFVPPVIAEALR 420

  Fly   883 MGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAY 947
            ..:.|....:...::.|:||..|..:|...:|.:::..:.||:..|||||..:..|||.::.|:|
 Worm   421 AAKTVPAQEFSDCSVIFTDIPDFFTISVNCSPTEIITVVTDLFHRFDRIIEKHKGYKVLSLMDSY 485

  Fly   948 MVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRY 1012
            ::|.|:|..| ..|..:..::||.||...|| .:..:...:::||||:|.||||||:|....||:
 Worm   486 LIVGGVPNAN-QYHCEDSLNLALGLLFEAKQ-VVVPKLERSVRLRIGVHCGPVVAGIVSQQKPRF 548

  Fly  1013 CLFGDTVNTASRMESNGEALKIHISNKCKLALDK-LGGGYITEKRGLVNMKGKGDVVTWWLTGAN 1076
            |:.|:|||....:.|:....|:.:||..:..:.| |...::....|.:.:: .|.|:|.:|. .|
 Worm   549 CVLGNTVNVTKSICSHSSPGKVLVSNAVRTMVTKHLKSIFVFNANGYLELQ-SGKVLTHFLE-KN 611

  Fly  1077 ENAIQKKLVD 1086
            |......:||
 Worm   612 EKCSVWDIVD 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 2/8 (25%)
HNOBA <835..881 CDD:285003 12/45 (27%)
CYCc 860..1052 CDD:214485 63/192 (33%)
Guanylate_cyc 887..1074 CDD:278633 60/187 (32%)
gcy-37NP_500171.2 HNOB 3..165 CDD:285002
HNOBA 223..419 CDD:285003 15/62 (24%)
CYCc 400..577 CDD:214485 61/178 (34%)
Nucleotidyl_cyc_III 425..609 CDD:299850 59/186 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.