DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and gcy-27

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001255957.2 Gene:gcy-27 / 191654 WormBaseID:WBGene00001550 Length:616 Species:Caenorhabditis elegans


Alignment Length:602 Identity:188/602 - (31%)
Similarity:313/602 - (51%) Gaps:71/602 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 RKWKIELEIEGLLWKIDPNEIKGYSGNEIVSSPSKVSLM-SAQSYGSRWTNQFVTSTGRLRG--A 576
            ||:|       :.||:....:|     .||:..:...:. ..::..::.....:||..|:.|  |
 Worm    29 RKYK-------MTWKVPKESLK-----IIVNKNADARMQRELENRTAKDEANALTSRRRVFGSYA 81

  Fly   577 VVRIKELKFPRKR-----DISREIMKEMRLLRELRHDNINSFIGASV--EPTRILLVTDYCAKGS 634
            ::..:..:|.:.|     ||:...:..:..|::|:|||:.:|.|..:  :...:.::.....:|:
 Worm    82 LIGTQRAEFIQFRQIKHIDITNASLDFLYNLKQLKHDNLANFYGIQLNDDLNTMTILHALVERGT 146

  Fly   635 LYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHEL 699
            |.:...:.|..:|:.|.::.:.|::||:.|:|.|.:.|||:|.::.|::...|:|::..:|:...
 Worm   147 LEEFCLDRDFGMDETFKSAFMRDILKGLQYLHLSPVAYHGHLHAATCLIDINWVLKIALYGVTNF 211

  Fly   700 RQC----AENESIGEHQ----HYRNQLWRAPELLRNH----------IHGSQKGDVYAFAIIMYE 746
             .|    |||.::.:..    .|...:...||.:|.:          :.||::||:|...:|.|.
 Worm   212 -VCDNFDAENITMPDRSDYTISYAQYVCFPPEHIREYDATGKLPTRFVRGSKQGDIYCVGMIFYM 275

  Fly   747 IFSRKGPFGQINFEPK-------EIVDYVKKLPLKGEDPFRPEVESIIEAESCPDYVLACIRDCW 804
            :..|:.|:..|:...:       ||:|:       ...||      |...|:..|.:|...::||
 Worm   276 MIEREDPYRLIHSVERPGSGLMMEILDH-------NLMPF------ISNNETQEDTLLDKCKECW 327

  Fly   805 AEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLL 869
            ..|||:||....:||.:.........|::|||:.|.||||:.||.:|..|:..|...:|:|..||
 Worm   328 NRDPEKRPTIENLRNAIAICYADSKGNLIDQMIRMNEKYADELETLVAARSADLALAQMQTMRLL 392

  Fly   870 HRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRG 934
            :.|||.|:|:.|..|......||...|:.|..|..|..:.....|.:|:.||||::..||.:|:.
 Worm   393 NEMLPASIAKDLKNGVIAPARSYASATVMFVQICDFIVILKRRPPKEVIGFLNDIFDQFDTVIKR 457

  Fly   935 YDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGP 999
            :|.|||||.|:.|||.||:|.:|..||..|:|.|:||:......:.:.:..|..|::|||.|.||
 Worm   458 HDAYKVETTGETYMVASGVPNENEGRHVFEVAEMSLEIRAISLSYTLENDKNYKLRVRIGFHAGP 522

  Fly  1000 VVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKI---HISNKCKLALDKLGGGYITEKRGLVNM 1061
            :.|||:|:..|||||||||||.||||:||...|:|   .|:.:..||..:    |...|||:|::
 Worm   523 IAAGVIGIKNPRYCLFGDTVNFASRMQSNCPPLQIQTSEITARMLLATHE----YKLVKRGIVHV 583

  Fly  1062 KGKGDVVTWWLTGANEN 1078
            ||||:|..:||   ||:
 Worm   584 KGKGEVNCYWL---NEH 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 73/318 (23%)
HNOBA <835..881 CDD:285003 21/45 (47%)
CYCc 860..1052 CDD:214485 81/194 (42%)
Guanylate_cyc 887..1074 CDD:278633 82/189 (43%)
gcy-27NP_001255957.2 PKc_like 75..338 CDD:304357 67/276 (24%)
CYCc 383..573 CDD:214485 81/193 (42%)
Guanylate_cyc 411..595 CDD:278633 82/190 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.