DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and acy-2

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_504553.1 Gene:acy-2 / 191607 WormBaseID:WBGene00000069 Length:1080 Species:Caenorhabditis elegans


Alignment Length:237 Identity:78/237 - (32%)
Similarity:120/237 - (50%) Gaps:38/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   844 ANNLEDIVTERTRLLCEEKMK--TEDLLHRMLP--------QSVAEKLTMGQGVE-PVS------ 891
            |..|.:.|..||.|   |.:|  .|.||..::|        :|:.:..:.|..|| |.:      
 Worm   236 ARKLTEAVYRRTEL---ETLKDRQEQLLLSVIPAYLADQVSKSIIQSSSTGSTVEVPRTGKNNTK 297

  Fly   892 ------------YDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIG 944
                        :|.|:|.|:|||.||.::|:.|...:|..||:||:.|||..:.....:::.:|
 Worm   298 NHKLFHDLHVQVHDNVSILFADIVNFTVLAAQLTAKDLVRTLNELYSKFDRDAQRLQCMRIKFLG 362

  Fly   945 DAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTM 1009
            |.|..|||:|: |...||.....|.||:::.:||.|||  ....:.:|||:|||.|:.|::||..
 Worm   363 DCYYCVSGMPV-NRPNHADMCVVMGLEMINTIKQVRIA--TGVDVNMRIGVHTGSVLCGIMGLRK 424

  Fly  1010 PRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGY 1051
            .::.::.|.|..|:.|||.|....:||:...|   |.|.|.|
 Worm   425 WQFDIWSDDVTLANHMESAGVPGAVHITKSTK---DMLLGDY 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 13/46 (28%)
CYCc 860..1052 CDD:214485 72/221 (33%)
Guanylate_cyc 887..1074 CDD:278633 64/184 (35%)
acy-2NP_504553.1 CYCc 253..463 CDD:214485 70/215 (33%)
Guanylate_cyc 308..459 CDD:278633 58/156 (37%)
CYCc 817..1034 CDD:214485
Guanylate_cyc 840..1054 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.