DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and LOC1269186

DIOPT Version :10

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_307792.5 Gene:LOC1269186 / 1269186 VectorBaseID:AGAMI1_012929 Length:338 Species:Anopheles gambiae


Alignment Length:107 Identity:24/107 - (22%)
Similarity:37/107 - (34%) Gaps:36/107 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 TEMICDGIAT------IFGPEGPCYVEAIVSQSR-----NIPMISYKCAEYRASAIPTFARTEPP 141
            |.|..||..:      |.||.....:..:...:|     .||:|:        .|..||...||.
Mosquito   174 TVMAMDGTGSDYCGHLILGPSCDFALAPVARIARYIYNDGIPVIT--------GAGYTFDFEEPK 230

  Fly   142 D-----------TQVVK------SLLALLRYYAWNKFSILYE 166
            .           |.:|.      .::.|:|::.||:....||
Mosquito   231 THCENEFHMLIRTGLVSFKRMAFFMIELIRHFNWNRVVYFYE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_SAP_GC-like 26..445 CDD:380593 24/107 (22%)
PK_GC-A_B 543..827 CDD:270944
HNOBA <833..881 CDD:462234
CYCc 860..1052 CDD:214485
LOC1269186XP_307792.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.