DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and Adcy6

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_006520366.3 Gene:Adcy6 / 11512 MGIID:87917 Length:1254 Species:Mus musculus


Alignment Length:236 Identity:77/236 - (32%)
Similarity:122/236 - (51%) Gaps:26/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   861 EKMKTED-------LLHRMLPQSVAEKLTMGQGVEPVSY----DLVTIYFSDIVGFT----AMSA 910
            ||.:.|:       |||.:||:.||......:......|    :.|.:.|:.|..|:    .:.|
Mouse  1019 EKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEA 1083

  Fly   911 ESTPLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDAYMVVSGLPIKNGDR----HAGEIASM 968
            .:..::.:..||::...||.||   |...:.|::|||..||..|||.....|:    |...:|..
Mouse  1084 NNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADY 1148

  Fly   969 ALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALK 1033
            |:.|:..:| |...|..| ..:::||::.|||||||:|...|:|.::|:|||.:|||:|.|...:
Mouse  1149 AMRLMEQMK-HINEHSFN-NFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDR 1211

  Fly  1034 IHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTG 1074
            |.::......|  ...||..|.||:|.:||||::.|::|.|
Mouse  1212 IQVTTDLYQVL--AAKGYQLECRGVVKVKGKGEMTTYFLNG 1250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 10/26 (38%)
CYCc 860..1052 CDD:214485 65/212 (31%)
Guanylate_cyc 887..1074 CDD:278633 66/201 (33%)
Adcy6XP_006520366.3 AC_N 83..454 CDD:318454
Guanylate_cyc 456..640 CDD:306677
DUF1053 668..754 CDD:368844
Guanylate_cyc 1056..1250 CDD:306677 66/197 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.