DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and ADCY3

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_011530791.1 Gene:ADCY3 / 109 HGNCID:234 Length:1186 Species:Homo sapiens


Alignment Length:272 Identity:77/272 - (28%)
Similarity:138/272 - (50%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 MEKYANNL---EDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMG-----QGVEPVSYDLVT 896
            :||.|..|   :..|.::...:.|.:...|.|:..|||:.||... :|     :.:...:||.:.
Human   902 VEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHF-LGSKKRDEELYSQTYDEIG 965

  Fly   897 IYFSDIVGF----TAMSAESTPLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDAYMVVSGL- 953
            :.|:.:..|    |..|..:..::.:.|||::.:.||.::   :...:.|::|||..||..||: 
Human   966 VMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMAASGVT 1030

  Fly   954 PIKNGD----------------RHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVA 1002
            |..|.:                :|..::|..||.:...:.  .|.::......|||||:.|.|:|
Human  1031 PDVNTNGFASSNKEDKSERERWQHLADLADFALAMKDTLT--NINNQSFNNFMLRIGMNKGGVLA 1093

  Fly  1003 GVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDV 1067
            ||:|...|.|.::|:|||.||||||.|....|.:..:.::.|.:.|..::  :||.:.:||||::
Human  1094 GVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFV--RRGPIFVKGKGEL 1156

  Fly  1068 VTWWLTGANENA 1079
            :|::|.|.::.|
Human  1157 LTFFLKGRDKLA 1168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 13/43 (30%)
CYCc 860..1052 CDD:214485 62/220 (28%)
Guanylate_cyc 887..1074 CDD:278633 61/210 (29%)
ADCY3XP_011530791.1 AC_N <44..303 CDD:292831
CYCc 273..490 CDD:214485
Guanylate_cyc 310..516 CDD:278633
CYCc 925..1143 CDD:214485 62/220 (28%)
Guanylate_cyc 956..1163 CDD:278633 61/210 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.