DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and Adcy4

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001348533.1 Gene:Adcy4 / 104110 MGIID:99674 Length:1077 Species:Mus musculus


Alignment Length:247 Identity:79/247 - (31%)
Similarity:124/247 - (50%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   858 LCEEKMKTED-------LLHRMLPQSVAEKLTMGQG-----VEPVSYDLVTIYFSDIVGFTAMSA 910
            |.:|:.:||.       ||..:||..||.:. :||.     :...||:.|.:.|:.:..|....:
Mouse   826 LRQEREETETMENLTRLLLENVLPAHVAPQF-IGQNRRNEDLYHQSYECVCVLFASVPDFKEFYS 889

  Fly   911 EST----PLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDAYMVVSGLPIKNGD--------- 959
            ||.    .|:.:..||::...||.::   :...|.|::|||..||..:||...:|.         
Mouse   890 ESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDSERS 954

  Fly   960 -RHAGEIASMALEL---LHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVN 1020
             .|.|.:...|:.|   |..:.:|..     ...:||:|::.|||||||:|...|:|.::|:|||
Mouse   955 CSHLGTMVEFAVALGSKLGVINKHSF-----NNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVN 1014

  Fly  1021 TASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWL 1072
            .||||||.|...||.::.:...||..|  ||....||.:.:||||::.|::|
Mouse  1015 VASRMESTGVLGKIQVTEETARALQSL--GYTCYSRGSIKVKGKGELCTYFL 1064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 10/29 (34%)
CYCc 860..1052 CDD:214485 69/223 (31%)
Guanylate_cyc 887..1074 CDD:278633 67/206 (33%)
Adcy4NP_001348533.1 AC_N <115..246 CDD:318454
Guanylate_cyc 264..418 CDD:306677
DUF1053 479..580 CDD:368844
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..524
Guanylate_cyc 866..1065 CDD:306677 67/206 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.