DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and LOC100333871

DIOPT Version :9

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_002666572.2 Gene:LOC100333871 / 100333871 -ID:- Length:243 Species:Danio rerio


Alignment Length:268 Identity:134/268 - (50%)
Similarity:173/268 - (64%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   872 MLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYD 936
            |||:.||:.|.:|:.::..||...|::||||||||.:|:.|||.|||:|||.|||.||.||..:|
Zfish     1 MLPKQVADDLRLGKPMQAQSYVSATVFFSDIVGFTQLSSTSTPYQVVDFLNKLYTTFDEIIDNHD 65

  Fly   937 VYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVV 1001
            ||||||||||||||||:|.:||..||.|||:|||:|:...|..||.|||...|::|.|:|:||||
Zfish    66 VYKVETIGDAYMVVSGVPRENGILHASEIANMALDLVSVCKTFRIPHRPQTQLQIRAGIHSGPVV 130

  Fly  1002 AGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGD 1066
            |||||..|||||||||||||||||||..|||||..|:.....|::: |||:...|||:.:|||||
Zfish   131 AGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAFYLLEEI-GGYLLTCRGLLQVKGKGD 194

  Fly  1067 VVTWWLTGANENAIQKKLVDMMDMPPPLFSRPRKSPKLNPDSRQPSIQAMHFCGTGSRRQSTVPR 1131
            :||:||.|.                   .|:..|.|....:|.:|..:...:        |::|.
Zfish   195 MVTYWLEGK-------------------CSKDMKKPATQQESEKPEAEKEDY--------SSIPG 232

  Fly  1132 AM-DGEST 1138
            .: ..|:|
Zfish   233 VLSSSENT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 5/8 (63%)
CYCc 860..1052 CDD:214485 111/179 (62%)
Guanylate_cyc 887..1074 CDD:278633 117/186 (63%)
LOC100333871XP_002666572.2 CYCc 1..179 CDD:214485 110/178 (62%)
Guanylate_cyc 16..202 CDD:278633 117/186 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.