DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtTFB1 and PFC1

DIOPT Version :9

Sequence 1:NP_648499.1 Gene:mtTFB1 / 8674019 FlyBaseID:FBgn0261381 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001322240.1 Gene:PFC1 / 839283 AraportID:AT1G01860 Length:346 Species:Arabidopsis thaliana


Alignment Length:264 Identity:71/264 - (26%)
Similarity:125/264 - (47%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RKQLSQNFLMDERLTDKIVKSAGRIDPRDLVLEVGPGPGGITRSILRRHPQRLLLVEKDPRFGET 97
            ||.|.|:::::..:.|::. ||..:...|.|||:|||.|.:| ::|......:|.:||||..   
plant    72 RKSLGQHYMLNSDINDQLA-SAADVKEGDFVLEIGPGTGSLT-NVLINLGATVLAIEKDPHM--- 131

  Fly    98 LQLLKECASPLNIQFDIHYDDILRFNIEQHI-----------PDTSQRIHLIGNLPFAIST---R 148
            :.|:.|..:..: :|.:..:|.::.:|..|:           || |....::.||||.|||   :
plant   132 VDLVSERFAGSD-KFKVLQEDFVKCHIRSHMLSILETRRLSHPD-SALAKVVSNLPFNISTDVVK 194

  Fly   149 LLINWLDDLAARRGAFRRIDTCMTLTFQQEVAERICAPVGGEQRCR-LSVMSQVWTEPVMKFTIP 212
            ||:. :.|:.::          :.|..|.|.|.|:..|.......| ::::...::||...|.:|
plant   195 LLLP-MGDIFSK----------VVLLLQDEAALRLVEPALRTSEYRPINILINFYSEPEYNFRVP 248

  Fly   213 GKAFVPKPQVDVGVVKLIPLKRPK-------TQLPFHLVERVVRHIFSMRQKYCRRGYGTLLPPE 270
            .:.|.|:|:||..|| ...||.|:       |:..|.||...    |:.::|..|:....:....
plant   249 RENFFPQPKVDAAVV-TFKLKHPRDYPDVSSTKNFFSLVNSA----FNGKRKMLRKSLQHISSSP 308

  Fly   271 DREE 274
            |.|:
plant   309 DIEK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtTFB1NP_648499.1 ksgA 18..310 CDD:234708 71/264 (27%)
PFC1NP_001322240.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I2371
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3942
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11727
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.