DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtTFB1 and DIM1A

DIOPT Version :9

Sequence 1:NP_648499.1 Gene:mtTFB1 / 8674019 FlyBaseID:FBgn0261381 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_182264.1 Gene:DIM1A / 819355 AraportID:AT2G47420 Length:353 Species:Arabidopsis thaliana


Alignment Length:269 Identity:74/269 - (27%)
Similarity:122/269 - (45%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KQLSQNFLMDERLTDKIVKSAGRIDPRDLVLEVGPGPGGITRSILRRHPQRLLLVEKDPRFGETL 98
            |...|:.|.:..|.|.||:.|| |...|::||:|||.|.:|:.:|.. .:.::.||.|.|.  .|
plant    30 KSKGQHILKNPLLVDSIVQKAG-IKSTDVILEIGPGTGNLTKKLLEA-GKEVIAVELDSRM--VL 90

  Fly    99 QLLKEC-ASPLN-----IQFDIHYDDILRFNIEQHIPDTSQRIHLIGNLPFAISTRLLINWLDDL 157
            :|.:.. .:|.:     ||.|:...::.||:|            .:.|:|:.||:.|...    |
plant    91 ELQRRFQGTPFSNRLKVIQGDVLKTELPRFDI------------CVANIPYQISSPLTFK----L 139

  Fly   158 AARRGAFRRIDTCMTLTFQQEVAERICAPVGGEQRCRLSVMSQVWTEPVMKFTIPGKAFVPKPQV 222
            .....:||    |..:.:|:|.|.|:.|..|....|||||.:|::........:....|.|.|:|
plant   140 LFHPTSFR----CAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYARVSHLLKVGKNNFRPPPKV 200

  Fly   223 DVGVVKLIPLKRPKTQLPFHLVERVVRHIFSMRQKYCRRGYGTLLPPEDREEVAEKLFQR----- 282
            |..||::.| :||..|:.....:..:|..|..:.|    ..|::...:....:.||.|:.     
plant   201 DSSVVRIEP-RRPGPQVNKKEWDGFLRVCFIRKNK----TLGSIFKQKSVLSMLEKNFKTLQAVL 260

  Fly   283 AEVQDTLRP 291
            |.:|:...|
plant   261 ASLQNNGEP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtTFB1NP_648499.1 ksgA 18..310 CDD:234708 74/269 (28%)
DIM1ANP_182264.1 PTZ00338 23..353 CDD:240367 74/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11727
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.