DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtTFB1 and Dimt1

DIOPT Version :9

Sequence 1:NP_648499.1 Gene:mtTFB1 / 8674019 FlyBaseID:FBgn0261381 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_079723.1 Gene:Dimt1 / 66254 MGIID:1913504 Length:313 Species:Mus musculus


Alignment Length:300 Identity:83/300 - (27%)
Similarity:139/300 - (46%) Gaps:36/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSARVLQSGMRLPPMPTIRELVKLYRLQARKQLSQNFLMDERLTDKIVKSAGRIDPRDLVLEVGP 68
            |.|:...|..|.......|||.:...|.....:.|:.|.:..:.:.|:..|. :.|.|:||||||
Mouse     2 PKAKSAASSRRRDRQEQRRELKRAGGLMFNTGIGQHILKNPLIVNSIIDKAA-LRPTDVVLEVGP 65

  Fly    69 GPGGITRSILRRHPQRLLLVEKDPRFGETLQLLKEC-ASPLNIQFDIHYDDILRFNIEQHIP--D 130
            |.|.:|..:|.: .::::..|.|||.  ..:|.|.. .:||..:..:...|:|:    ..:|  |
Mouse    66 GTGNMTVKLLEK-AKKVVACELDPRL--VAELHKRVQGTPLASKLQVLVGDVLK----SDLPFFD 123

  Fly   131 TSQRIHLIGNLPFAISTRLLINWLDDLAARRGAFRRIDTCMTLTFQQEVAERICAPVGGEQRCRL 195
            .     .:.|||:.||:..:..    |...|..||    |..|.||:|.|.|:.|..|.:..|||
Mouse   124 A-----CVANLPYQISSPFVFK----LLLHRPFFR----CAILMFQREFALRLVAKPGDKLYCRL 175

  Fly   196 SVMSQVW--TEPVMKFTIPGK-AFVPKPQVDVGVVKLIPLKRPKTQLPFHLVERVVRHIFSMRQK 257
            |:.:|:.  .:.:||.   || .|.|.|:|:..||::.| |.|...:.|...:.:||..|..:.|
Mouse   176 SINTQLLARVDHLMKV---GKNNFRPPPKVESSVVRIEP-KNPPPPINFQEWDGLVRITFVRKNK 236

  Fly   258 YCRRGYGTLLPPEDREEVAEKLFQ-RAEVQDTLRPFELTV 296
            .....:.:    ...:::.||.:: ...||:|:.|.:.::
Mouse   237 TLSAAFKS----SAVQQLLEKNYRIHCSVQNTVIPEDFSI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtTFB1NP_648499.1 ksgA 18..310 CDD:234708 79/285 (28%)
Dimt1NP_079723.1 PTZ00338 27..312 CDD:240367 76/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.