DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtTFB1 and dimt1l

DIOPT Version :9

Sequence 1:NP_648499.1 Gene:mtTFB1 / 8674019 FlyBaseID:FBgn0261381 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001003556.2 Gene:dimt1l / 445162 ZFINID:ZDB-GENE-040801-75 Length:306 Species:Danio rerio


Alignment Length:281 Identity:76/281 - (27%)
Similarity:128/281 - (45%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MPTIR--------ELVKLYRLQARKQLSQNFLMDERLTDKIVKSAGRIDPRDLVLEVGPGPGGIT 74
            ||.::        :.||...:.....:.|:.|.:..:.:.|::.|. :.|.|:|||||||.|.:|
Zfish     1 MPKVKAEKKSRTHQEVKSQGIMFNTGIGQHILKNPLVVNGIIEKAA-LRPTDVVLEVGPGTGNMT 64

  Fly    75 RSILRRHPQRLLLVEKDPRFGETLQLLKECASPLNIQFDIHYDDILR-----FNIEQHIPDTSQR 134
            ..:|.: .::::..|.|.|....||...:| :|:..:..|...|:|:     |::          
Zfish    65 VKLLEK-AKKVVACELDTRLVAELQKRVQC-TPMQNKLQILIGDVLKTELPFFDV---------- 117

  Fly   135 IHLIGNLPFAISTRLLINWLDDLAARRGAFRRIDTCMTLTFQQEVAERICAPVGGEQRCRLSVMS 199
              .:.|||:.||:..:..    |...|..||    |..|.||:|.|.|:.|..|.:..||||:.:
Zfish   118 --CVANLPYQISSPFVFK----LLLHRPFFR----CAVLMFQREFAMRLVAKPGDKLYCRLSINT 172

  Fly   200 QVW--TEPVMKFTIPGK-AFVPKPQVDVGVVKLIPLKRPKTQLPFHLVERVVRHIFSMRQKYCRR 261
            |:.  .:.:||.   || .|.|.|:|:..||::.| |.|...:.|...:.:||..|..:.|    
Zfish   173 QLLARVDHLMKV---GKNNFRPPPKVESSVVRIEP-KNPPPPVNFQEWDGLVRIAFVRKNK---- 229

  Fly   262 GYGTLLPPEDREEVAEKLFQR 282
                :|....:....|||.::
Zfish   230 ----MLSAAFKSAAVEKLLEK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtTFB1NP_648499.1 ksgA 18..310 CDD:234708 76/281 (27%)
dimt1lNP_001003556.2 PTZ00338 16..305 CDD:240367 74/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.