DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and asgr1c.1

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:XP_001339584.3 Gene:asgr1c.1 / 799199 ZFINID:ZDB-GENE-060526-151 Length:521 Species:Danio rerio


Alignment Length:155 Identity:39/155 - (25%)
Similarity:71/155 - (45%) Gaps:19/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VAGALEALQT-----TNDTFVRIGNSYYLIER-------KLQKNWFGAYEICRQQQAELISLETF 76
            :..||:.|.:     |.|..|:...|.:::.:       :.|.:|..|.:.|:||:|.|:.::..
Zfish   370 ILNALKGLMSNTSAKTADVPVKSCKSGWIVYKSSCFFFSETQVSWSEARDYCKQQEASLLKIQDD 434

  Fly    77 DELRLVSEYLLANNIFERYWTSGTDLGTKGKHVWF-SNGQPLSTDLWYGGEPNNKNNEEHCDELG 140
            :|   ...:|..:.|.:.||...||..| |:..|. .....::.:.|..|:|::..|....:| |
Zfish   435 NE---EWSFLKNHTIPKHYWVGLTDQNT-GQWRWVDETPYSINKERWNQGQPDDWKNHGLGEE-G 494

  Fly   141 SDFRPTKSPG-MNDRNCNFESSFIC 164
            .|.......| :||.:|:.:..|||
Zfish   495 EDCGHISYTGKLNDIHCSTKIRFIC 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 32/129 (25%)
asgr1c.1XP_001339584.3 CwlO1 114..>341 CDD:443091
CLECT_DC-SIGN_like 393..519 CDD:153060 31/130 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.