DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and lectin-24A

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster


Alignment Length:140 Identity:41/140 - (29%)
Similarity:66/140 - (47%) Gaps:12/140 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ALEALQTTNDTFVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNI 91
            |:..:|.....|.:||:.|:.||..::.||..|...||:....|.|::|..|...:.|.|   :.
  Fly   151 AINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKL---DD 212

  Fly    92 FERYWTSGTDLGTK-GKHVWFSNGQPLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRN 155
            .:.|:. |.:..|| |..|..::|:......|..|||::.|::|.|..:   .|.....|    |
  Fly   213 SKSYFL-GVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSI---LRKLMHVG----N 269

  Fly   156 CNFESSFICE 165
            |.:|..|||:
  Fly   270 CTYEKRFICQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 35/120 (29%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 36/122 (30%)

Return to query results.
Submit another query.