DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and clec10a

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:XP_012815686.1 Gene:clec10a / 496661 XenbaseID:XB-GENE-947983 Length:338 Species:Xenopus tropicalis


Alignment Length:152 Identity:41/152 - (26%)
Similarity:61/152 - (40%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VAGALEALQTTNDTFVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYL-- 86
            |.|:.|.|  ..|.:.|...|.|.:. |....|..|.:.|....|.|:.:...||    .||:  
 Frog   203 VNGSQEPL--CPDNWHRFTLSCYYVS-KSGYPWEEAKKRCEGLSAHLVVINNEDE----QEYVFG 260

  Fly    87 LANNIFERYWTSGTDLGTKGKHVWFSNGQPLSTD--LWYGGEPNN-----KNNEEHCDELGSDFR 144
            :|...|.  |...||  ::|:..|. :|.|.:|.  .|...:|:|     ....|.|..|..:.:
 Frog   261 IAKGQFT--WIGLTD--SEGEWKWL-DGTPYNTSPKFWIADQPDNYFGHGLGGGEDCAHLHYNGQ 320

  Fly   145 PTKSPGMNDRNCNFESSFICEE 166
                  .||.:|:....||||:
 Frog   321 ------WNDDHCSRRYRFICEK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 32/128 (25%)
clec10aXP_012815686.1 PqiB <91..201 CDD:442245
CLECT_DC-SIGN_like 211..336 CDD:153060 36/140 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.