DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and CG11211

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster


Alignment Length:140 Identity:36/140 - (25%)
Similarity:62/140 - (44%) Gaps:23/140 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNIFER------YWTSGTD 101
            |:|:.:....:.||..|..:|.:..|.|.::...::.:|:..|:   |..||      :|...|:
  Fly    39 NAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYV---NRKERIFGNRTFWLGATN 100

  Fly   102 LGTKGKH-VWFSNGQPLSTDLWYGGEP-NNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFIC 164
            |..:... .|.|.|.|::...|...|| :::..::.|..||:|......|      |..:.:|||
  Fly   101 LVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEP------CQRKHNFIC 159

  Fly   165 EEVQPKYNVC 174
            |      |||
  Fly   160 E------NVC 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 30/127 (24%)
CG11211NP_610208.1 CLECT 49..160 CDD:153057 29/119 (24%)

Return to query results.
Submit another query.