DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and lectin-21Cb

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster


Alignment Length:131 Identity:37/131 - (28%)
Similarity:67/131 - (51%) Gaps:14/131 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNIFERYWTSGTDL 102
            |.::|:.|:.|||.:::|||.|.:.||:....|.:.:..|||.|:.:.|.|    ..:|...::|
  Fly   132 FQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEA----RWFWLDISNL 192

  Fly   103 GTKGKHVWFSNGQPLSTDLWYGGEPNNKNNEEHCDEL-GSDFRPTKSPGMNDRNCNFESSFICEE 166
            ..|.:::..:.|:.:|...|..||| .|::..:|..| ..|:...:        |:..:.|||:.
  Fly   193 VDKDQYISLATGKEVSYLKWRHGEP-KKSSTANCAYLYAGDYYTYQ--------CSDRNFFICQA 248

  Fly   167 V 167
            |
  Fly   249 V 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 33/120 (28%)
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 33/122 (27%)

Return to query results.
Submit another query.