DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and CD209

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:133 Identity:39/133 - (29%)
Similarity:61/133 - (45%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TFVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNIFERYWTSGTD 101
            ||.: ||.|::  ...|:||..:...|::..|:|:.:::.:|...:......:|.|.  |...:|
Human   261 TFFQ-GNCYFM--SNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFT--WMGLSD 320

  Fly   102 LGTKGKHVWFSNGQPLSTDL---WYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFI 163
            |..:|...|. :|.||....   |..|||||. .||.|.|...:       |.||..||....:|
Human   321 LNQEGTWQWV-DGSPLLPSFKQYWNRGEPNNV-GEEDCAEFSGN-------GWNDDKCNLAKFWI 376

  Fly   164 CEE 166
            |::
Human   377 CKK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 34/122 (28%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59
GumC <53..>225 CDD:442439
neck domain 60..249
CLECT_DC-SIGN_like 256..379 CDD:153060 39/131 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.