DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and Colec10

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:172 Identity:44/172 - (25%)
Similarity:78/172 - (45%) Gaps:33/172 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IVKLTGSTTFLVALFLFEVSRNVAGALEALQTTNDTFVRIGNSYYLIERKLQKNWFGAYEICRQQ 66
            :.:|..|..|:         :||   :..::.|.:.|      ||:::.  :||:..:...||.:
  Rat   135 VARLKTSMKFI---------KNV---IAGIRETEEKF------YYIVQE--EKNYRESLTHCRIR 179

  Fly    67 QAELISLETFDEL--RLVSEYLLANNIFERYWTSGTDLGTKGKHVWFSNGQPLST-DLWYGGEPN 128
            ...|...:  ||:  .|:::|:..:..| |.:....||..:|::| |::..||.. ..|..|||:
  Rat   180 GGMLAMPK--DEVVNTLIADYVAKSGFF-RVFIGVNDLEKEGQYV-FTDNTPLQNYSNWKEGEPS 240

  Fly   129 NKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFICEEVQPK 170
            :....|.|.|:.|..|      .||..|:....|:||.|:.|
  Rat   241 DPYGHEDCVEMLSSGR------WNDTECHLTMYFVCEFVKKK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 33/122 (27%)
Colec10NP_001124013.1 gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 35/132 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.