DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and CLEC2D

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001004419.1 Gene:CLEC2D / 29121 HGNCID:14351 Length:194 Species:Homo sapiens


Alignment Length:87 Identity:22/87 - (25%)
Similarity:37/87 - (42%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLVALFLFEVSRNVAGALEALQTT--NDTFVRI----GNSYYLIERKL------QKNWFGAYEIC 63
            |.:.:||..:...:..||.|::..  .:..|.:    ..|:...:||.      .|||..:...|
Human    39 FFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFC 103

  Fly    64 RQQQAELISLETFDELRLVSEY 85
            ..|.|:|..:|:|.||..:..|
Human   104 DSQDADLAQVESFQELNFLLRY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 14/47 (30%)
CLEC2DNP_001004419.1 CLECT_NK_receptors_like 75..171 CDD:153063 15/51 (29%)

Return to query results.
Submit another query.