DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and Reg1a

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_036773.1 Gene:Reg1a / 24714 RGDID:3552 Length:165 Species:Rattus norvegicus


Alignment Length:135 Identity:34/135 - (25%)
Similarity:53/135 - (39%) Gaps:33/135 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YYLIERKLQKNWFGAYEICRQQQA-ELISLETFDELRLVSEYLLANNIFERYWTSGTDLGTKGKH 108
            ||.:|..|  :|..|...|:...: .|:|:     |.......||:.|.|.        ||...:
  Rat    47 YYFMEDHL--SWAEADLFCQNMNSGYLVSV-----LSQAEGNFLASLIKES--------GTTAAN 96

  Fly   109 VW-------------FSNGQPLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFES 160
            ||             :|:|.......|..|.||| :|..:|..:.|:....|   ..|.:|:.:.
  Rat    97 VWIGLHDPKNNRRWHWSSGSLFLYKSWDTGYPNN-SNRGYCVSVTSNSGYKK---WRDNSCDAQL 157

  Fly   161 SFICE 165
            ||:|:
  Rat   158 SFVCK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 33/133 (25%)
Reg1aNP_036773.1 CLECT 35..163 CDD:470576 34/135 (25%)

Return to query results.
Submit another query.