DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and Asgr1

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_036635.1 Gene:Asgr1 / 24210 RGDID:2160 Length:284 Species:Rattus norvegicus


Alignment Length:127 Identity:32/127 - (25%)
Similarity:49/127 - (38%) Gaps:22/127 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KNWFGAYEICRQQQAELISLETFDELRLVSEYL--------LANNIFERYWTSGTDLGTKGKHVW 110
            |.|..|.:.|:.:.|.|:.:.:::|.|.|.:::        |.:......|..|||..|     .
  Rat   172 KPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYET-----G 231

  Fly   111 FSNGQPLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFICEEVQPKYN 172
            |.|.:|...|.|||   :.....|.|....:|..      .||..|.....::||....|.|
  Rat   232 FKNWRPGQPDDWYG---HGLGGGEDCAHFTTDGH------WNDDVCRRPYRWVCETELGKAN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 28/118 (24%)
Asgr1NP_036635.1 Lectin_N 4..143 CDD:461106
Endocytosis signal. /evidence=ECO:0000255 5..8
CLECT_DC-SIGN_like 153..278 CDD:153060 29/119 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.