DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and FCER2

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001993.2 Gene:FCER2 / 2208 HGNCID:3612 Length:321 Species:Homo sapiens


Alignment Length:124 Identity:28/124 - (22%)
Similarity:53/124 - (42%) Gaps:14/124 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNIFERYWTSGTDLGTKGKHV 109
            ||.  .|..|.|..|...|...:.:|:|:.:.:|    .::|..:......|....:|..||:.:
Human   175 YYF--GKGTKQWVHARYACDDMEGQLVSIHSPEE----QDFLTKHASHTGSWIGLRNLDLKGEFI 233

  Fly   110 WFSNGQPLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFE-SSFICEEV 167
            |. :|..:....|..|||.:::..|.|..:....|      .||..|:.: .:::|:.:
Human   234 WV-DGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGR------WNDAFCDRKLGAWVCDRL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 27/120 (23%)
FCER2NP_001993.2 CENP-F_leu_zip 48..>148 CDD:463102
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..85
Repetitive region 69..89
Repetitive region 90..110
Repetitive region 111..131
CLECT 163..282 CDD:214480 27/119 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..321
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.