DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and Reg3a

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_035389.1 Gene:Reg3a / 19694 MGIID:109408 Length:175 Species:Mus musculus


Alignment Length:124 Identity:35/124 - (28%)
Similarity:53/124 - (42%) Gaps:22/124 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KNWFGAYEICRQQ-QAELISLETFDELRLVSEYLLANNIFERY---WTSGTDLGTKGKHV----W 110
            |:||.|..:|::: ...|:|:.:..|...||.  |.|...:.|   |. |....|.|:..    |
Mouse    59 KSWFQADLVCQKRPSGHLVSILSGGEASFVSS--LVNGRVDNYQDIWI-GLHDPTMGQQPNGGGW 120

  Fly   111 -FSNGQPLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGM---NDRNCNFESSFICE 165
             :||...|:...| .|:|::..|..||..|      |.|.|.   .|..|:....|:|:
Mouse   121 EWSNSDVLNYLNW-DGDPSSTVNRGHCGSL------TASSGFLKWGDYYCDGTLPFVCK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 34/122 (28%)
Reg3aNP_035389.1 CLECT 40..173 CDD:470576 35/124 (28%)
Sufficient to activate EXTL3. /evidence=ECO:0000250|UniProtKB:Q06141 103..118 4/15 (27%)

Return to query results.
Submit another query.