DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and clec-205

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_503500.2 Gene:clec-205 / 178657 WormBaseID:WBGene00021602 Length:557 Species:Caenorhabditis elegans


Alignment Length:148 Identity:32/148 - (21%)
Similarity:54/148 - (36%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TTNDT-FVRIGNSYYLIERKLQKNWFGAYEICRQQQ------AELISLETFDELRLVSEYL--LA 88
            |||.| |..:.|:........:|.:..|..:|....      .:|.|:||.:|...|...:  ::
 Worm   419 TTNFTYFSGLANTKCYRVSSDKKQFAEAENLCLSDHPLFLHTPKLTSIETKEEEEKVRTIVPPVS 483

  Fly    89 NNIFERYWTSGTDLGTKGKHVWFSNGQPLSTDL--WYGGEPNNKNNEEHCDELGSDFRPTKSPGM 151
            :.:|   |.......|...:.:|.||....:..  |..|.|.:.:.   ||        ..:..:
 Worm   484 DGMF---WFGLKRDPTNSSNWYFINGDTYDSSYQNWRSGYPRDADG---CD--------CVALVI 534

  Fly   152 NDR-----NCNFESSFIC 164
            ||.     :||.:...||
 Worm   535 NDNSWVNTDCNKQLYSIC 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 26/135 (19%)
clec-205NP_503500.2 CLECT <77..156 CDD:470576
CLECT 432..552 CDD:153057 24/133 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.