DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and clec-204

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_503499.2 Gene:clec-204 / 178656 WormBaseID:WBGene00021603 Length:551 Species:Caenorhabditis elegans


Alignment Length:151 Identity:33/151 - (21%)
Similarity:55/151 - (36%) Gaps:34/151 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TTNDTFVRIGNS--YYLIERKLQKNWFGAYEICRQQQ------AELISLET---FDELR-LVSEY 85
            ||...|..:.|:  |.:...|  |.:..|..:|..:.      .:|.|:||   .|::| |:...
 Worm   405 TTFKYFESLHNAKCYRVSSEK--KQFVDAENLCLSKHPLFLHTPKLTSIETKIEEDQVRTLIHTQ 467

  Fly    86 LLANNIFERYWTSGTDLGTKGKHVWFSNGQPLSTDL--WYGGEPNNKNNEEHCDELGSDFRPTKS 148
            .|.|.  ..:|.......:...:.:|.||....:..  |..|.|.:.:.   ||        ..:
 Worm   468 PLVNE--GMFWFGLKRDPSNSSNWYFINGDTYDSSYQNWRSGYPRDADG---CD--------CVA 519

  Fly   149 PGMNDR-----NCNFESSFIC 164
            ..:||.     :||.:...||
 Worm   520 LVINDNSWVNTDCNKQLYSIC 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 29/137 (21%)
clec-204NP_503499.2 CLECT <68..>116 CDD:470576
CLECT 414..540 CDD:214480 28/140 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.