DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24F and CLEC4M

DIOPT Version :10

Sequence 1:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:133 Identity:40/133 - (30%)
Similarity:66/133 - (49%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TFVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNIFERYWTSGTD 101
            ||.: ||.|::  ...|:||..:...|::.:|:|:.::|.:|...:......:|.|.  |...:|
Human   273 TFFQ-GNCYFM--SNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFS--WMGLSD 332

  Fly   102 LGTKGKHVWFSNGQPLSTDL---WYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFI 163
            |..:|...|. :|.|||...   |..|||||..||:..:..||        |.||..|:.::.:|
Human   333 LNQEGTWQWV-DGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGS--------GWNDNRCDVDNYWI 388

  Fly   164 CEE 166
            |::
Human   389 CKK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 35/122 (29%)
CLEC4MNP_055072.3 Endocytosis signal. /evidence=ECO:0000250 14..15
transmembrane domain 44..71
YhaN <58..>266 CDD:443752
7 X approximate tandem repeats 108..269
CLECT_DC-SIGN_like 268..391 CDD:153060 40/131 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.