DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and WFDC8

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:XP_016883608.1 Gene:WFDC8 / 90199 HGNCID:16163 Length:247 Species:Homo sapiens


Alignment Length:114 Identity:24/114 - (21%)
Similarity:37/114 - (32%) Gaps:49/114 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIWTILALTADIN---GLV--------------CN--------------------LEPFVQ---- 29
            |.||...||..|.   ||.              ||                    ::||.:    
Human    33 LEWTSAMLTKKIKHKPGLCPKERLTCTTELPDSCNTDFDCKEYQKCCFFACQKKCMDPFQEPCML 97

  Fly    30 ----GSCLELTDLYSYVEYKN-DCV--YWQGCLLNGNHFSKKEECEDMC 71
                |:|......:.: ::|| .|.  .::||..|.|:|..::.|...|
Human    98 PVRHGNCNHEAQRWHF-DFKNYRCTPFKYRGCEGNANNFLNEDACRTAC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 15/94 (16%)
WFDC8XP_016883608.1 WAP 47..90 CDD:459672 4/42 (10%)
KU 93..145 CDD:197529 11/52 (21%)
WAP 150..190 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.