DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and spint1a

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:XP_073783238.1 Gene:spint1a / 406426 ZFINID:ZDB-GENE-040426-2169 Length:523 Species:Danio rerio


Alignment Length:67 Identity:18/67 - (26%)
Similarity:30/67 - (44%) Gaps:3/67 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TILALTADINGLVCNLEPFVQGSCLELTDLYSYVEYKNDCVYWQ--GCLLNGNHFSKKEECEDMC 71
            :||.||.:.:...| |.|..:|.|......:.|......|..::  ||:.|.|::....||:..|
Zfish   234 SILVLTREQSLHHC-LVPKKEGPCRGSFPRWHYNAATEKCEEFKFGGCVPNRNNYLALNECQSAC 297

  Fly    72 KQ 73
            .:
Zfish   298 NK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 13/51 (25%)
spint1aXP_073783238.1 None

Return to query results.
Submit another query.