| Sequence 1: | NP_001162864.1 | Gene: | CG42465 / 8674015 | FlyBaseID: | FBgn0259955 | Length: | 73 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001123248.1 | Gene: | Wfikkn1 / 363555 | RGDID: | 1565835 | Length: | 552 | Species: | Rattus norvegicus |
| Alignment Length: | 55 | Identity: | 21/55 - (38%) |
|---|---|---|---|
| Similarity: | 26/55 - (47%) | Gaps: | 3/55 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 19 GLVCNLEPFVQGSCLELTDLYSYVEYKNDC--VYWQGCLLNGNHFSKKEECEDMC 71 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42465 | NP_001162864.1 | Kunitz-type | 21..71 | CDD:444694 | 19/51 (37%) |
| Wfikkn1 | NP_001123248.1 | WAP | 32..81 | CDD:459672 | |
| KAZAL_FS | 124..159 | CDD:238052 | |||
| IgI_3_WFIKKN-like | 190..284 | CDD:409422 | |||
| Ig strand A | 190..193 | CDD:409422 | |||
| Ig strand A' | 198..201 | CDD:409422 | |||
| Ig strand B | 206..213 | CDD:409422 | |||
| Ig strand C | 220..225 | CDD:409422 | |||
| Ig strand C' | 226..228 | CDD:409422 | |||
| Ig strand D | 230..235 | CDD:409422 | |||
| Ig strand E | 243..249 | CDD:409422 | |||
| Ig strand F | 263..271 | CDD:409422 | |||
| Ig strand G | 274..284 | CDD:409422 | |||
| Kunitz-type | 302..355 | CDD:444694 | |||
| Kunitz_WFIKKN_2-like | 362..414 | CDD:438649 | 20/53 (38%) | ||
| NTR_like | 431..541 | CDD:470599 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||