DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42465 and Wfikkn1

DIOPT Version :10

Sequence 1:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster
Sequence 2:NP_001123248.1 Gene:Wfikkn1 / 363555 RGDID:1565835 Length:552 Species:Rattus norvegicus


Alignment Length:55 Identity:21/55 - (38%)
Similarity:26/55 - (47%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GLVCNLEPFVQGSCLELTDLYSYVEYKNDC--VYWQGCLLNGNHFSKKEECEDMC 71
            |.||.|.| |||.|......::|......|  ..:.||..|.|:|..:|.|||.|
  Rat   360 GDVCALPP-VQGPCQGWEPRWAYSPLLQQCHPFIYSGCEGNSNNFESRESCEDAC 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 19/51 (37%)
Wfikkn1NP_001123248.1 WAP 32..81 CDD:459672
KAZAL_FS 124..159 CDD:238052
IgI_3_WFIKKN-like 190..284 CDD:409422
Ig strand A 190..193 CDD:409422
Ig strand A' 198..201 CDD:409422
Ig strand B 206..213 CDD:409422
Ig strand C 220..225 CDD:409422
Ig strand C' 226..228 CDD:409422
Ig strand D 230..235 CDD:409422
Ig strand E 243..249 CDD:409422
Ig strand F 263..271 CDD:409422
Ig strand G 274..284 CDD:409422
Kunitz-type 302..355 CDD:444694
Kunitz_WFIKKN_2-like 362..414 CDD:438649 20/53 (38%)
NTR_like 431..541 CDD:470599
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.